Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
Online Inquiry
| CAT# | G16005 |
| M.W/Mr. | 3355.7 |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G16032 |
GLP-2 (1-34), Glucagon-Like Peptide-2 (1-34), human |
|
|
Inquiry |
| G16012 |
(Des-His1,Glu9)-Glucagon (1-29) amide (human, rat, porcine) |
|
|
Inquiry |
| G16002 |
Glucagon - Like Peptide 1, GLP - 1 (7 - 36), amide, human |
|
|
Inquiry |
| G05007 |
[Des-His1,Glu9] Glucagon |
|
|
Inquiry |
| G05008 |
Glucagon, human |
|
|
Inquiry |
Write a review
Ask a question
My Review for Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
Required fields are marked with *
×
Ask a Question for Glucagon - Like Peptide 1, GLP - 1 (7 - 37)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
