CAT# | G05009 |
M.W/Mr. | 3841.1 |
Sequence | FAM-HSQGTFTSDYSKYLDSRRAQDFVQWLMNT |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
The toxin BeKm 1 is a HERG-specific peptide toxin, which are voltage-gated K+ channels, coded by the human ether ...
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
What is palmitoyl hexapeptide-12? Lipopeptides, also known as acylpeptides, consist of a hydrophilic peptide bond and a lipo ...