GLP-1 (7-36), amide, chicken, common turkey
GLP-1 (7-36), amide, chicken, common turkey
Online Inquiry
| CAT# | G16004 |
| M.F/Formula | C149H224N40O47 |
| M.W/Mr. | 3327.7 |
| Sequence | AEGTYTSDITSYLEGQAAKEFIAWLVNGR-NH2 |
| CAT# |
Product Name |
M.W |
Molecular Formula |
Inquiry |
| G16008 |
GLP - 2 (1 - 34), Glucagon - Like Peptide - 2 (1 - 34), human |
|
|
Inquiry |
| G16024 |
GLP-1 (9-36) amide (human, bovine, guinea pig, mouse, porcine, rat) |
|
|
Inquiry |
| G16018 |
GLP-1 (1-36) amide (human, bovine, guinea pig, mouse, rat) |
|
|
Inquiry |
| G05009 |
Glucagon (1 - 29), bovine, human, porcine, FAM- - labeled |
|
|
Inquiry |
| G05001 |
Glucagon (22-29), human |
|
|
Inquiry |
Write a review
Ask a question
My Review for GLP-1 (7-36), amide, chicken, common turkey
Required fields are marked with *
×
Ask a Question for GLP-1 (7-36), amide, chicken, common turkey
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
