CAT# | G13001 |
Sequence | VFGTLGSTDDSLFGRYKQDIFNDHRGHLQGQAYGSR |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
PAC-113, as well as a new type of Trp-rich peptide, is a 12 amino-acid fragment of the saliva protein histatin 5 ...