[Gln22, Asn23]-beta-Amyloid (1-40), E22Q/D23N Dutch/Iowa double mutation

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	A13267
M.W/Mr.	4327.9
Sequence	DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV

CAT#	Product Name	Inquiry
A13292	[Gly22]-beta-Amyloid (1-42), Arctic Mutation	Inquiry
A13304	[Gln22]-beta-Amyloid (1-42), E22Q Dutch Mutation	Inquiry
CAD-007	(Des-Glu22)-Amyloid β-Protein (1-40)	Inquiry
A13303	[Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation	Inquiry
A13301	[Gly21]-beta-Amyloid (1-42), A21G Flemish Mutation	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of elcatonin in treatment of osteoporosis

Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...

Function of JIP1 in Promoting Axonal Growth

JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...

Very Late Antigen-4 blocker-BIO 1211

BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...

Function of Abarelix in Advanced Prostate Cancer

Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: