Keywords Search Google Search Search

Glicentin-Related Peptide (21-50), human

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	E10011
M.W/Mr.	3383.5
Sequence	RSLQDTEEKSRSFSASQADPLSDPDQMNED-NH2

CAT#	Product Name	Inquiry
E10004	Des His1, Glu8 Exendin-4	Inquiry
E10007	Exendin (10-39)	Inquiry
E10005	Exendin-4 (3-39)	Inquiry
E10013	Exendin-4 (1-8)	Inquiry
E10012	Trp Cage	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Overview of tetrapeptide-26

Antioxidant effect of peptides Peptides have been isolated from the resultant by-products in the past 15 years and suggested ...

The mechanism and effect of hexapeptide-9

of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...

The Function of Dalbavancin in Acute Bacterial Skin and Skin Tissue Infections (ABSSSI)

Dalbavancin, marketed under the brand name of Dalvance, is a new semi-synthetic glycopeptide antibiotic for anti ...

Function of the Econazole and its derivative

Econazole, commonly used as sulfosalicylate and nitrate salt, is an imidazole broad-spectrum antifungal drug, wh ...

The Usage of Pentapeptide-31

of skin aging Skin aging is an obvious external manifestation of the natural process occurring in tissues and or ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: