CAT# | G02010 |
M.W/Mr. | 5002.7 |
Sequence | YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNITQ |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Basic information Desmopressin is a synthetic analogue of the antidiuretic hormone vasopressin used in the treatment of centr ...
Trimetazidine is a partial fatty acid oxidation inhibitor that inhibits 3-ketoacyl CoA thiolase, one of the enzymes of fatty ...
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Pep2m, a peptide inhibitor of GluA2 subunit binding to NSF, reduces α-amino- 3-hydroxy-5-methyl-isoxazolepropion ...
Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...