CAT# | AF2884 |
Sequence | GLPQDCERRGGFCSHKSCPPGIGRIGLCSKEDFCCRSRWYS |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
The peptide neuroprotectant Tat-NR2B9c, also known as NA-1, is a Tat peptide consisting of the nine C-terminal ...
MCL 0020 is a synthetic tripeptide with the structure of Ac-D-2Nal-Arg-2Nal-NH2 (2-Nal= 3-(2-naphthyl)-L-alanine ...
PM102 is a novel synthetic peptide that effectively reverses the anticoagulant effect of heparin. It can be used ...
With the advancement of technology and the increasing demand for skin care, the variety of ingredients in the skin care marke ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...