CAT# | AF2747 |
Sequence | RYHMQCGYRGTFCTPGKCPHGNAYLGLCRPKYSCCRWL |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...
Development of Trofinetide Trofinetide was found in 2002 by Brimble's team at the University of Auckland i ...
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...
Long-term potentiation (LTP) is a persistent synaptic enhancement which is thought to be a substrate for memory. ...