CAT# | AF2719 |
Sequence | IATQCRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
MEN 10376 (Asp-Tyr-D-Trp-Val-D-Trp-D-Trp-Lys-NH2) is an analogue of Neurokinin A (NKA), which has a selective af ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...