CAT# | AF3083 |
Sequence | FTMKKSLLLLFFLGTINLSLCEKERNAEEEKRDGDDETDVEVQK |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
Figure 1. Chemical structure of pentagastrinPentagastrin, known as peptavlon, is a synthetic pentapeptide that p ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...
Glucagon-like peptide-1 (GLP-1) and glucose-depended insulinotropic polypeptide (GIP) are the two peptides that have been con ...