FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)
FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)
FRETS-VWF73 is a very powerful Fluorescence-Quenching Substrate for the VWF cleaving protease ADAMTS-13. It is commonly used as a useful tool for the rapid measurement of ADAMTS-13 activity in plasma and is a predictive marker for various thrombotic diseases like TPP. Our new substrate FRETS-VWF73 can be easily used with a 96-well format in commercial plate readers.
Online Inquiry
| CAT# | X21214 |
| M.W/Mr. | 8314.9 |
| Sequence | One Letter Code: DRE-Dap(Nma)-APNLVYMVTG-Dap(Dnp)-PASDEIKRLPGDIQVVPIGVGPNANVQELERIGWPNAPILIQDFETLPREAPDLVLQR
Three Letter Code: H-Asp-Arg-Glu-Dap(Nma)-Ala-Pro-Asn-Leu-Val-Tyr-Met-Val-Thr-Gly-Dap(Dnp)-Pro-Ala-Ser-Asp-Glu-Ile-Lys-Arg-Leu-Pro-Gly-Asp-Ile-Gln-Val-Val-Pro-Ile-Gly-Val-Gly-Pro-Asn-Ala-Asn-Val-Gln-Glu-Leu-Glu-Arg-Ile-Gly-Trp-Pro-Asn-Ala-Pro-Ile-Leu-Ile-Gln-Asp-Phe-Glu-Thr-Leu-Pro-Arg-Glu-Ala-Pro-Asp-Leu-Val-Leu-Gln-Arg-OH |
| Storage | -20°C |
References | K. Kokame, et al. Br. J. Haematol., 129, 93-100 (2005) |
Write a review
Ask a question
My Review for FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)
Required fields are marked with *
×
Ask a Question for FRETS-VWF73 (Fluorescence-Quenching Substrate for ADAMTS-13)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
