[Des - His1, Glu9] - Glucagon (1 - 29), amide

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	G05006
M.W/Mr.	3358.7
Sequence	SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2

CAT#	Product Name	Inquiry
G05010	Oxyntomodulin / Glucagon 37	Inquiry
G16033	(Asp28)-Glucagon (1-29) (human, rat, porcine)	Inquiry
G16003	(Ser8)-GLP-1 (7-36), amide, human	Inquiry
G16005	Glucagon - Like Peptide 1, GLP - 1 (7 - 37)	Inquiry
10-101-351	Retatrutide	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Kassinin in Stimulating Ion Transport in Skin

Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...

Function of FC 131 as CXCR4 antagonists

The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...

Medicinal effect of zonisamide for seizures

Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...

Palmitoyl pentapeptide: bioactive peptide for anti-aging and skin care

Palmitoyl Pentapeptide, a peptide with significant biological activity, has attracted attention for its anti-aging effect on ...

Glucagon-like peptide-1 (7-36) amide

The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: