CAT# | R0996 |
CAS | 697327-12-1 |
M.F/Formula | C175H294N54O49S5 |
M.W/Mr. | 4098.88 |
Sequence | SCNTATCMTHRLVGLLSRSGSMVRSNLLPTKMGFKVFG(Modifications: Disulfide bridge between 2 - 7, Gly-38 = C-terminal amide) |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
Somatostatin is the main hemostatic drug in the clinic, and its derivative octreotide has been confirmed by many ...
Enfuvirtide, also named pentafuside, is an HIV fusion inhibitor originated at Duke University, where researchers ...