CAT# | C0032 |
CAS | 86280-64-0 |
M.F/Formula | C₁₈₃H₃₀₇N₅₇O₆₁ |
M.W/Mr. | 4281.8 |
Sequence | One Letter Code: AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY three Letter Code: H-Ala-Arg-Pro-Ala-Lys-OH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
PMX-53, a chemically synthesized peptide material, is a potent C5a antagonist in human neutrophils and macrophag ...
Camstatin is a similar PEP-19 analogue with enhanced calmodulin binding and antagonism. It is a functional 25- ...
Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
Teriparatide is a human parathyroid hormone analog with the same structure as the N-terminal 34 amino acid seque ...