CAT# | C0032 |
CAS | 86280-64-0 |
M.F/Formula | C₁₈₃H₃₀₇N₅₇O₆₁ |
M.W/Mr. | 4281.8 |
Sequence | One Letter Code: AREQSNATQLDGPARELLLRLVQLAGTQESVDSAKPRVY three Letter Code: H-Ala-Arg-Pro-Ala-Lys-OH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Aprotinin is a natural proteinase inhibitor polypeptide derived from bovine lung tissue. It is a monomeric glo ...
Acetyl Glutamyl Heptapeptide-3, named SNAP-8, Acetyl GlutaMyl Octapeptide-3, Acetyl Octapeptide-1, Acetyl Octape ...
The 70-kDa heat shock protein (HSP70) contains three domains: the ATPase N-domain, which hydrolyses ATP, the sub ...
Anisomycin, also known by its trade name flagecidin, is a bacterial pyrrolidine antibiotic mostly isolated from ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...