CAT# | C28001 |
M.F/Formula | C177H279N49O58 |
M.W/Mr. | 4021.46 |
Sequence | ASDRSNATQLDGPAGALLLRLVQLAGAPEPFEPAQPDAY |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Purotoxin 1, a component from the venom of Geolycosa spiders, exerts selective inhibitory action on P2X3 recep ...
The sodium channel subtypes NaV1.2 and NaV1.6 are the two major forms of excitatory pyramidal neurons in the cer ...
Dynorphin A (1-13) [Dyn-A (1-13)] is a short-chain polypeptide containing 13 amino acids and having extensive bi ...
Peptide YY is referred to as PYY. Its structure is highly homologous with pancreatic polypeptide (PP) and neurop ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...