CJC1295 Without DAC

Modified Growth Releasing Factor aminos 1-29, usually referred to as Modified GRF (1-29) or "ModGRF(1-29)," also known as CJC-1295 without DAC, is a synthetic analog of the endogenous peptide signaling hormone Growth Hormone Releasing Hormone (GHRH).

Online Inquiry

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	HB00107
Chemical Structure
CAS	863288-34-0
Synonyms/Alias	CJC-1295(2MG);CJC-1295(10mg);CJC-1295 Acetate;CJC-1295 CJC-1295;CJC1295 with out DAC;CJC-1295 Without DAC 86328-34-0;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl
M.F/Formula	C152H252N44O42
M.W/Mr.	3367.89688
Biological Activity	CJC-1295 without DAC is synthetic analog of Growth Hormone Releasing Factor (GRF) also known as Growth Hormone Releasing Hormone (GHRH).

CAT#	Product Name	Inquiry
10-101-336	Indium In-111 pentetreotide	Inquiry
HB00083	TAT peptide	Inquiry
10-101-55	Rotigaptide	Inquiry
10-101-243	METHYL 2-METHOXYPROPIONATE	Inquiry
10-101-346	H-D-Phe-Pip-Arg-pNA.2HCl	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Storage	Desiccate at -20°C
Shipping Condition	Room temperature in continental US; may vary elsewhere.