β-CGRP, human
Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain
Online Inquiry
| CAT# | R1862 |
| CAS | 101462-82-2 |
| Synonyms/Alias | Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human |
| M.F/Formula | C162H267N51O48S3 |
| M.W/Mr. | 3793.41 |
| Sequence | One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF
Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 |
| Application | Neuropeptide |
| Appearance | White or off-white lyophilized powder |
| Source# | Synthetic |
Storage | Store the unopened product at -20 to -70 °C. Use a manual defrost freezer and avoid repeated freeze-thaw cycles. Do not use past expiration date. |
Solubility | 10 mM in H2O |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
Write a review
Ask a question
My Review for β-CGRP, human
Required fields are marked with *
×
Ask a Question for β-CGRP, human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
