We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
Calcitonin Gene Related Peptide (CGRP) is a highly potent vasodialator and can function in the transmission of pain
CAT No: R1862
CAS No: 101462-82-2
Synonyms/Alias: Human β-CGRP; CGRP-II (Human); Calcitonin Gene Related Peptide II, human
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C162H267N51O48S3 |
M.W/Mr. | 3793.41 |
Sequence | One Letter Code: [C2C7]ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF Three Letter Code: [Cys2-Cys7] Ala-Cys-Asn-Thr-Ala-Thr-Cys-Val-Thr-His-Arg-Leu-Ala-Gly-Leu-Leu-Ser-Arg-Ser-Gly-Gly-Met-Val-Lys-Ser-Asn-Phe-Val-Pro-Thr-Asn-Val-Gly-Ser-Lys-Ala-Phe-NH2 |
Application | Neuropeptide |
Appearance | White or off-white lyophilized powder |
Source# | Synthetic |
Long-term Storage Conditions | 10 mM in H2O |
Shipping Condition | Wet ice in continental US; may vary elsewhere |
2. Myotropic activity of allatostatins in tenebrionid beetles
3. Emu oil in combination with other active ingredients for treating skin imperfections
5. Low bone turnover and low BMD in Down syndrome: effect of intermittent PTH treatment
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com