CAT# | AF2659 |
Sequence | NEDLGTRKPVSFTVKETVCPRTTHQPAEQCGFKERGR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...
R18 peptide is a non-phosphorylated ligand of 14-3-3 that was originally isolated from a phage display screen, ...