CAT# | C06008 |
M.W/Mr. | 3414.9 |
Sequence | CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP-NH2 |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What is Trofinetide? Trofinetide is a neuropeptide synthesized from the breakdown product of insulin-like grow ...
Peptides are compounds formed by linking α-amino acids by peptide bonds, and are intermediate products of proteolysis. They a ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
Orexin A (OXA) and orexin B (OXB) are hypothalamic neuropeptides discovered in 1998, which bind to two G-protein ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...