CAT# | AF2957 |
Sequence | QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Thymosin Thymosin is a hormone secreted from the thymus. This is the reason why it is named Thymosin. But most are now known ...
BIO 1211, is a non-covalent, small-molecule, cyclohexanecarboxylic acid base compound, tight-binding inhibitor ( ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...