CAT# | AF2957 |
Sequence | QVVRNPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCRRW |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
Sinapultide (also known as KL4 peptide) is a synthetic protein used to mimic human SP-B. Respiratory distress ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Resveratrol is also known as stilbene III. Its chemical name is (E)-3,5,4-trihydroxystilbene. It is a non-fla ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...