CAT# | AF2519 |
Sequence | NPQSCRWNMGVCIPISCPGNMRQIGTCFGPRVPCCR |
Activity | Antimicrobial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
BIM 189 is one of the most potent bombesin antagonists known in the guinea pig and 3T3 cell systems but has 40% ...
Foreword We live in a photoshopped world, where we are constantly updated by images of digital perfection. It's easy to becom ...
Tertiapin-Q (TPN-Q) is a small compact protein that contains twenty-one amino acids, which derived from bee veno ...
Myristoyl pentapeptide-7, a cosmetic peptide, is a synthetic peptide containing lysine and threonine residues, w ...
As a small actin-binding protein upregulated in highly metastatic prostate cancer cells, thymosin β15 (Tβ15) has ...