CAT# | AF2449 |
Sequence | NEPVSCIRNGGICQYRCIGLRHKIGTCGSPFKCCK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Trifluoroacetyl tripeptide-2 (TFA-T2) is an innovative peptide compound that has garnered significant attention in dermatolog ...
The cyclopentapeptide FC 131 (cyclo(-L-Arg1-L-Arg2-L-2-Nal3-Gly4-D-Tyr5-), 2-Nal=3-(2-naphthyl) alanine)) is an ...
MEN 11270 (H-DArg-Arg-Pro-Hyp-Gly-Thi-c(Dab-Dtic-Oic-Arg)c(7γ-10α)) is a novel selective constrained peptide ant ...
Vasoconstrictor substances, such as norepinephrine and epinephrine, have been mingled with local anesthetics to ...
Acetyl pepstatin, nature products of yeast fermentation, is general inhibitors of the family of aspartic proteas ...