CAT# | A13236 |
M.W/Mr. | 4014.6 |
Sequence | FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Galanin-(2–13)-Glu-His-(Pro)3-(Ala-Leu)2-Ala-amide (M871) is a novel peptide antagonist selectively recognizing ...
Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...
NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...