CAT# | AF2479 |
Sequence | CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCRRK |
Activity | Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Today, many attempts have been made to reduce or stop the aging effect on the skin. As the skin ages, wrinkles, lines, brown ...
Endothelin-1 (ET-1) is a vasoactive peptide containing 21 amino acids, which was first isolated from the culture ...
Margatoxin (MgTX) is a 39 amino acid peptide with significant sequence homology to charybdotoxin (ChTX), and ha ...
Lecirelin, a synthetic hormone, is a strongly basic nonapeptide with sequence yr-His-Trp-Ser-Tyr-tBu-D-Gly-Leu-A ...
GRK2i, a GRK2 inhibitory polypeptide, specifically inhibits Gβγ activation of GRK2. It corresponds to the Gβγ-bi ...