β-Amyloid 1-40
β-Amyloid (1-40) is a primary protein in plaques found in the brains of patients with Alzheimer's disease.
Online Inquiry
| CAT# | R1778 |
| Chemical Structure |  |
| CAS | 131438-79-4 |
| M.F/Formula | C194H295N53O58S1 |
| M.W/Mr. | 4329.82 |
| Sequence | One Letter Code: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Three Letter Code: Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val |
| Biological Activity | Peptide found in plaques in the brains of patients with Alzheimer's disease. Shown to have both neurotrophic and neurotoxic effects. |
| Storage | Desiccate at -20°C |
Solubility | Soluble to 1 mg/ml in water |
Shipping Condition | Room temperature in continental US; may vary elsewhere. |
Write a review
Ask a question
My Review for β-Amyloid 1-40
Required fields are marked with *
×
Ask a Question for β-Amyloid 1-40
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
