Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human
Adrenomedullin (AM) (22-52), human is an adrenomedullin receptor antagonist, and also antagonizes the calcitonin generelated peptide (CGRP) receptor in the hindlimb vascular bed of the cat.
Online Inquiry
| CAT# | R1175 |
| CAS | 159899-65-7 |
| Synonyms/Alias | 22-52-Adrenomedullin (human) |
| M.F/Formula | C₁₅₉H₂₅₂N₄₆O₄₈ |
| M.W/Mr. | 3576.04 |
| Sequence | One Letter Code: TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
three Letter Code: Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
| Source# | Synthetic |
Storage | -20 ± 5 °C |
Write a review
Ask a question
My Review for Adrenomedullin (AM) (22-52), human
Required fields are marked with *
×
Ask a Question for Adrenomedullin (AM) (22-52), human
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
