Adrenomedullin(1-52) is a 52-amino acid peptide with multi-functions. It was originally isolated from pheochromocytoma and adrenal medulla but is widely distributed throughout the body including lung and kidney tissues. Besides controlling fluid-electrolyte homeostasis, adrenomedullin is a potent vasodilator and can inhibit pituitary ACTH secretion.
CAT# | R1864 |
CAS | 148498-78-6 |
Synonyms/Alias | Human adrenomedullin; Adrenomedullin (human); Human adrenomedullin-(1-52)-NH2 |
M.F/Formula | C264H406N80O77S3 |
M.W/Mr. | 6029 |
Sequence | One Letter Code: YRQSMNNFQGIRSFGC1RFGTC1TVQKLAHQITQFTDKDKDNVAPRSKISPQGY Three Letter Code: H-Tyr-Arg-Gln-Ser-Met-Asn-Asn-Phe-Gln-Gly-Ile-Arg-Ser-Phe-Gly-Cys(1)-Arg-Phe-Gly-Thr-Cys(1)-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
Appearance | White or off-white lyophilized powder |
Purity | > 95% |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Nafarelin acetate is a gonadotropin-releasing hormone (GnRH) agonist which is as effective as danazol in the tre ...
Ecallantide, sold under the trade name Kalbitor, is a plasma kallikrein inhibitor, consisting of sixty amino aci ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...