Peptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.F/Formula | C206H308N56O58S |
M.W/Mr. | 4529.2 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF |
Length | 39 |
2. Immune responses to homocitrulline-and citrulline-containing peptides in rheumatoid arthritis
3. Peptides as Active Ingredients: A Challenge for Cosmeceutical Industry
4. Autoinhibition and phosphorylation-induced activation of phospholipase C-γ isozymes
5. The spatiotemporal control of signalling and trafficking of the GLP-1R
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.