CAT# | A03024 |
M.F/Formula | C206H308N56O58S |
M.W/Mr. | 4529.2 |
Sequence | SYSMEHFRWGKPVGKKRRPVKVYANGAEEESAEAFPLEF |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
Discovery and Structure Calcitonin, also called thyrocalcitonin, a protein hormone synthesized and secreted in humans and oth ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Nociceptin/orphanin FQ (N/OFQ) modulates various biological functions, including nociception, via selective stim ...
Etomidate, a highly selective intravenous anesthetic agent, was first synthesized at Janssen Pharmaceuticals in ...