CAT# | S14004 |
Sequence | ACKGEGVKGCYDKPDDWCCKKTPCKCPAWSHERECRCTQPCARRCR |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...
What are copper peptides? Copper peptides are tripeptide molecules composed of three amino acids that combine with copper io ...
AdTx1, also called as ρ-Da1a, is a polypeptide of 65 amino acids stabilized by four disulfide bonds, which has a ...
of Tripeptide-1 The tripeptide-1 (glycyl-L-histadyl-L-lysine or GHK) is primarily known as carrier peptides. It ...
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...