CAT# | P03042 |
M.F/Formula | C202H325N61O54S |
M.W/Mr. | 4504.3 |
Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
The peptide st-Ht31 P, A-kinase anchoring protein (AKAP) inhibitor, has the negative control for st-Ht31. In DRG ...
Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...
Factors of natural aging Natural aging of the skin results in decreased production and increased degradation of extracellula ...