CAT# | AF1883 |
Sequence | CSTNTFSLSDYWGNKGNWCTATHECMSWCK |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Kassinin, a new peptide of amphibian origin, has been traced in the skin of the African frog Kassina senegalensi ...
DAMME (DA) is a guanine, often referred to as FK 33-824 (FK), which is a long-acting enkephalin analog. Natur ...
of skin aging Skin aging is the obvious external manifestation of a natural process occurring in tissues and or ...
Gap 19 is a nonapeptide derived from the cytoplasmic loop (CL) of Connexin-43 (Cx43). Cx43 is a predominant card ...
Secretin is a 27 amino acid polypeptide that is released during acidification in the duodenal cavity and stim ...