CAT# | AF3246 |
Sequence | IFNSIYHRKCVVKNRCETVSGHKTCKDLTCCRAVIFRHERPEVCRPST |
Activity | Gram+ & Gram-, |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Insulin was discovered by Banting and Best in 1921. Soon afterwards manufacturing processes were developed to extract the ins ...
Urantide is a UⅡ receptor antagonist. It can effectively alleviate monocrotaline (MCT)-induced PAH in a rat mode ...
Somatostatin (SST) is a peptide compound synthesized by neuroendocrine cells and other cells that can label tumo ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
Secretin belongs to the vasoactive intestinal peptide/pituitary adenylate cyclase activating peptide family an ...