SARS-CoV-2 Spike RBD (receptor binding domain), 395-430

This peptide sequence represents residues 395-430 of the RBD (receptor binding domain) identified from the RefSeq (YP_009724390.1) from the spike protein of SARS-CoV-2.

Online Inquiry

Specification Technical Data Related Products Featured Products Customer reviews and Q&A Useful Tools Publications

CAT#	S29017
Sequence	One Letter Code: VYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFT Three-Letter Code: H-Val-Tyr-Ala-Asp-Ser-Phe-Val-Ile-Arg-Gly-Asp-Glu-Val-Arg-Gln-Ile-Ala-Pro-Gly-Gln-Thr-Gly-Lys-Ile-Ala-Asp-Tyr-Asn-Tyr-Lys-Leu-Pro-Asp-Asp-Phe-Thr-OH
Purity	95%

CAT#	Product Name	Inquiry
S29009	SARS-CoV-2 Spike RBD (receptor binding domain), 336-347	Inquiry
S29005	SARS-CoV Peptide Antigen Pos control	Inquiry
S29011	SARS-CoV-2 Spike RBD (receptor binding domain), 348-357	Inquiry
S29001	(Biotin-LC)-SARS-CoV-2 Spike RBM (receptor binding motif), 438-458	Inquiry
S29010	SARS-CoV-2 Spike RBD (receptor binding domain), 336-347- Lys(Biotin-LC)	Inquiry

CAT#	Product Name	M.W	Molecular Formula	Inquiry
10-101-20	Goserelin Acetate	1269.43	C59H84N18O14	Inquiry
10-101-59	Liraglutide	3751.2	C172H265N43O51	Inquiry
R1574	Octreotide	1019.24	C₄₉H₆₆N₁₀O₁₀S₂	Inquiry
10-101-139	Myrcludex B			Inquiry
10-101-285	Teduglutide	3752.08	C164H252N44O55S	Inquiry
R1847	Sermaglutide	4114	C187H291N45O59	Inquiry
R1961	Carbetocin	988.2	C45H69N11O12S	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Peptidic Antagonist to CRF2 Receptor–Astressin 2B

Astressin 2B is a peptidic antagonist to CRF2 (corticotrophin-releasing factor 2) receptor with structure of cyc ...

BA 1, a potent BRS-3 agonist

BA 1 (DTyr-Gln-Trp-Ala-Val- Ala-His-Phe-Nle-NH2) is a potent BRS-3 agonist (IC50 = 2.52 nM) and a NMBR and GRPR ...

Function of myristoyl hexapeptide-4 for improvement of skin

Myristoyl hexapeptide-4, a stabilized peptide, is a synthetic peptide containing lysine, threonine and serine re ...

Function of basic fibroblast growth factor in skin

Basic Fibroblast Growth Factor, Human, called basic fibroblast growth factor (bFGF/FGF-b/FGF-2), is a single cha ...

The Function of Dipeptide-4 in Human Skin

An of Dipeptide A Peptide is a constituent fragment in the structure of a protein and is linked by an amide bond ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Size	0.5 mg
Storage	-20 °C
References	1. Wan Y, Shang J, et al. Receptor recognition by the novel coronavirus from Wuhan: an analysis based on decade-long structural studies of SARS coronavirus. J Virol. 2020 Mar 17;94(7). 2. Chen Y, et al. Structure analysis of the receptor binding of 2019-nCoV. Biochem Biophys Res Commun. 2020 Feb 17.