RYR2 (2460-2495)
This is amino acids 2460 to 2495 fragment of cardiac ryanodine receptor (RyR2). RyR2 controls calcium release from the sarcoplasmic reticulum, which begins muscle contraction. Mutated RyR2 is associated to ventricular tachycardia (VT) and sudden death.
Online Inquiry
| CAT# | X21218 |
| M.W/Mr. | 4104.1 |
| Sequence | One Letter Code: GFCPDHKAAMVLFLDRVYGIEVQDFLLHLLEVGFLP
Three Letter Code: H-Gly-Phe-Cys-Pro-Asp-His-Lys-Ala-Ala-Met-Val-Leu-Phe-Leu-Asp-Arg-Val-Tyr-Gly-Ile-Glu-Val-Gln-Asp-Phe-Leu-Leu-His-Leu-Leu-Glu-Val-Gly-Phe-Leu-Pro-OH |
| Storage | -20°C |
References | Jiang, D. et al. Proc Natl Acad Sci U S A 101, 35 (2004). |
Write a review
Ask a question
My Review for RYR2 (2460-2495)
Required fields are marked with *
×
Ask a Question for RYR2 (2460-2495)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
