CAT# | AF2371 |
Sequence | KPYCSCKWRCGIGEEEKGICHKFPIVTYVCCRRP |
Activity | Antibacterial |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Elcatonin acetate, a physicochemically and biologically stable synthetic derivative of calcitonin transformed fr ...
The factors of skin aging The skin is one of the largest organs of the body. In many cases, as the person's age changes, the ...
An overview of Tripeptide-10 Citrulline Signal oligopeptides are commonly synthesized from portions of EMPs and from natural ...
GR 82334 is a spirolactam analog with the structure of [[(S, S) Pro-Leu (spiro-γ-lactam)]9,10, Trp11] Physalaemi ...
UFP-803 (H-Asp-c[Pen-Phe-DTrp-Dab-Tyr-Cys]-Val-OH), [Pen 5, DTrp 7, Dab 8] U-II (4-11), is a peptidic UT (urote ...