CAT# | S07007 |
M.F/Formula | C161H260N44O45 |
M.W/Mr. | 3532.1 |
Sequence | APSDPRLRQFLQKSLAAAAGKQELAKYFLAEL |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Studies on the binding affinities of darifenacin hydrobromide and human muscarinic receptor subtypes show strong ...
Zonisamide, sold as brand name Zonegran, is a derivative of 3-(sulfamoylmethyl)-l,2-benzisoxazole. It is a membe ...
Corticotropin-releasing factor (CRF) is a 41 amino acid peptide that is an important hormone in the hypothalamic ...
DAPTA (D-[Ala]-Ser-Thr-Thr-Thr-Asn-Tyr-Thr-amide), D-Ala-Peptide T amide, is one of analogue of peptide T, which ...
What is palmitoyl tripeptide-38? Palmitoyl tripeptide-38 (PT-38), named MATRIXYL synthe'6 and Volulip, a cosmetic peptide or ...