CAT# | A13300 |
M.W/Mr. | 4498.1 |
Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAPIGLMVGGVVIA |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
What are collagen peptides? Collagen peptides are repair collagen, and the protein slowly decreases with age. It can be see ...
Propofol, known as 2,6-Diisopropyl phenol, is mainly used in the induction and maintenance of general anesthesia ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
KAI-1455, a ε-protein kinase C activator in Phase I testing for the treatment of ischemia-induced reperfusion i ...
NFAT, the nuclear factor of activated T cells, is a family of transcription factors that play an important role ...