1. Home
  2. Products
  3. Catalog Peptides
  4. Adrenomedullin Peptides
  5. Prepro-adrenomedullin (153-185), human

Prepro-adrenomedullin (153-185), human

Prepro-adrenomedullin (153-185), human, encompasses motifs guiding proper folding and conversion to mature peptide forms. Side-chain clustering supports studies on sorting, processing, and secretory trafficking. Conformational mapping reveals intermediate stages of precursor assembly. Researchers utilize this fragment in biosynthesis, metabolic modeling, and peptide design work.

Designed for biological research and industrial applications, not intended for individual clinical or medical purposes.

CAT No: A05009

Custom Peptide Synthesis
cGMP Peptide
  • Registration of APIs
  • CMC information required for an IND
  • IND and NDA support
  • Drug master files (DMF) filing
M.W/Mr.
3219.6
Sequence
SLPEAGPGRTLVSSKPQAHGAPAPPSGSAPHFL
Length
33

Useful Tools

Peptide Calculator

Abbreviation List

Peptide Glossary

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Featured Services
Custom Conjugation ServicePeptide Analysis ServicesEpitope Mapping ServicescGMP Peptide ServicePeptide Modification ServicesPeptide Synthesis ServicesPeptide CDMOPeptide Nucleic Acids Synthesis
Hot Products
Thymosin β4 Acetate

Thymosin β4 Acetate promotes wound healing, tissue repair, and cell regeneration. Buy Thymosin beta 4 peptide powder for research on recovery and regenerative medicine.

Read More Read More
Alarelin acetate

Alarelin Acetate is a high-purity synthetic peptide used in fertility and ovulation research. Buy Alarelin peptide online from a trusted peptide supplier for advanced hormonal studies.

Read More Read More
Carbetocin

Carbetocin is a synthetic oxytocin analog that promotes uterine contraction and postpartum recovery. Buy Carbetocin peptide powder from a professional supplier for reproductive research.

Read More Read More
Terlipressin

Terlipressin is a synthetic vasopressin analog that supports vascular and renal research. Purchase Terlipressin peptide from a verified supplier for liver and hemodynamic studies.

Read More Read More
DOTA-cyclo(RGDfK) acetate

DOTA-cyclo(RGDfK) acetate is a metal-chelating cyclic RGD peptide used to investigate integrin-binding motifs. Its cyclized structure stabilizes ligand presentation for receptor-targeting studies. Researchers analyze its conformation for high-affinity binding models. The DOTA moiety supports imaging-related biochemical experiments.

Read More Read More
Buserelin Acetate

Buserelin Acetate is a GnRH agonist peptide regulating reproductive hormones. Buy Buserelin peptide powder online to explore fertility and hormone-dependent tumor research.

Read More Read More
Somatostatin

Somatostatin peptide inhibits the secretion of growth hormone and insulin. Purchase high-purity Somatostatin for metabolic, neuroendocrine, and cancer research.

Read More Read More
Angiotensin II Acetate

Angiotensin II Acetate is a potent research peptide regulating blood pressure and vascular tone. Purchase this synthetic peptide to support cardiovascular and renal studies.

Read More Read More
Terlipressin Acetate

Terlipressin Acetate is a synthetic vasopressin analog peptide used for vascular and liver research. Buy Terlipressin peptide powder online from a trusted peptide supplier for professional studies.

Read More Read More
Teriparatide Acetate

Teriparatide Acetate is a bone-forming peptide supporting osteoporosis research. Buy Teriparatide peptide online to study bone growth and calcium metabolism.

Read More Read More
About us

Creative Peptides is a trusted CDMO partner specializing in high-quality peptide synthesis, conjugation, and manufacturing under strict cGMP compliance. With advanced technology platforms and a team of experienced scientists, we deliver tailored peptide solutions to support drug discovery, clinical development, and cosmetic innovation worldwide.

From custom peptide synthesis to complex peptide-drug conjugates, we provide flexible, end-to-end services designed to accelerate timelines and ensure regulatory excellence. Our commitment to quality, reliability, and innovation has made us a preferred partner across the pharmaceutical, biotechnology, and personal care industries.

Our Customers