CAT# | P24001 |
Sequence | QEDLKYFEREVVAELAAQILRVAQGPSAFVAGPH |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Delmitide, also known as RDP58, is a novel D-amino acid decapeptide with anti-inflammatory effect. RDP58 is a te ...
The immunomodulator mifamurtide (liposomal muramyltripeptide phosphatidyl ethanolamine [L-MTP-PE]) is a syntheti ...
Rotigaptide is a novel antiarrhythmic peptide that enhances gap junction (GJ) intercellular conductance between cardiomyocy ...
Cyclosporin A (CsA) is a cyclic polypeptide consisting of 11 amino acids, which contains a new amino acid contai ...
Ganirelix, a synthetic decapeptide compound, is a gonadotrophin-releasing hormone (GnRH) antagonist preparation ...