CAT# | P03024 |
M.F/Formula | C175H274N52O48S2 |
M.W/Mr. | 3938.6 |
Sequence | SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Abarelix, sold under the brand name Plenaxis, is a synthetic decapeptide and Gonadotropin-releasing hormone (GnR ...
of skin aging Natural aging of the skin results in decreased production and increased degradation of extracellu ...
Linaclotide, sold under the brand name Linzess, is a synthetic tetradecapeptide and guanylate cyclase (GC-C) rec ...
Icatibant, sold under the trade name Firazyr, is a plasma kallikrein inhibitor and the bradykinin B2 receptor an ...
NG-monomethyl-L-arginine (L-NMMA) acetate, a structural analogue of L-arginine, also named tilarginine acetate a ...