Keywords Search Google Search Search

Parathyroid Hormone (3-34), bovine

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	P03024
M.F/Formula	C175H274N52O48S2
M.W/Mr.	3938.6
Sequence	SEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF

CAT#	Product Name	Inquiry
P03054	Hypercalcemia Malignancy Factor (7-34), amide, human	Inquiry
P03049	Parathyroid Hormone Related Peptide (107-111)	Inquiry
P03017	[Tyr34] Parathyroid Hormone (7-34), amide, bovine	Inquiry
P03058	Parathyroid Hormone (1-34), human	Inquiry
P03006	Parathyroid Hormone (28-48), human	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

CXCR4 antagonist-TC 14012

TC 14012 is a serum-stable derivative of the peptidomimetic T140, which is a cyclic peptide with the structure o ...

MC1R antagonist-MSG 606

MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...

Function of myristoyl pentapeptide-11 in skin

Myristoyl pentapeptide-11 is classified to cosmetic peptide and single peptide, a common saturated fatty acid, w ...

The Function of Deferasirox in Iron Overload

Iron chelating agent is a new type of iron-removing treatment based on the combination of directional and in viv ...

Function of Histrelin Acetate in Prostate Cancer

Histrelin acetate, sold under many brand name like Vantas, Supprelin LA and others, is a nonapeptide analog of g ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: