PACAP (1-38), human, ovine, rat
PACAP (1-38), human, ovine, rat
PACAP (1-38), human, ovine, rat is a neuropeptide with 38 amino acid residues. PACAP (1-38) binds to PACAP type I receptor, PACAP type II receptor VIP1, and PACAP type II receptor VIP2 with IC50s of 4 nM, 2 nM, and 1 nM, respectively.
Online Inquiry
| CAT# | R1591 |
| CAS | 137061-48-4 |
| Synonyms/Alias | Pituitary Adenylate Cyclase Activating Polypeptide 38 |
| M.F/Formula | C₂₀₃H₃₃₁N₆₃O₅₃S |
| M.W/Mr. | 4534.26 |
| Sequence | One Letter Code: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
three Letter Code: His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
Write a review
Ask a question
My Review for PACAP (1-38), human, ovine, rat
Required fields are marked with *
×
Ask a Question for PACAP (1-38), human, ovine, rat
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
