Keywords Search Google Search Search

Noxa A BH3 peptide, cell permeable

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	C08174
M.W/Mr.	3555.2
Sequence	DRDRDRDRDRDRDRDRGAELPPEFAAQLRKIGDKVYC

CAT#	Product Name	Inquiry
X07323	PM_15755677	Inquiry
X09727	PM_18948118	Inquiry
X10531	PM_20159462	Inquiry
X16845	PM_9730898	Inquiry
M34140657H	Surfactin	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Glucagon-like peptide-1 (7-36) amide

The mammalian precursor gene proglucagon, which contains the glucagon sequence together with two structurally related glucago ...

Function of lysipressin in diabetes insipidus

Figure 1. Chemical structure of lysipressinLysipressin ([Lys8]-vasopressin) has been identified in the North Ame ...

Orexin Peptides

Brief information of orexin peptide The past several years have provided important insights into the physiological significan ...

Palmitoyl pentapeptide-4

An overview of Palmitoyl pentapeptide-4 The potential of topical peptides to improve aging skin has been widely discussed in ...

Guangxitoxin 1E, a potent KV2.1 and KV2.2 channel blocker

Guangxitoxin 1E is a KV2.1 and KV2.2 specific channel blocker (IC50 values are 1-3 nM). The experimental results ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: