Keywords Search Google Search Search

Noxa A BH3 peptide, cell permeable

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	C08174
M.W/Mr.	3555.2
Sequence	DRDRDRDRDRDRDRDRGAELPPEFAAQLRKIGDKVYC

CAT#	Product Name	Inquiry
X06907	PM_15279623	Inquiry
X20337	UP_P84863	Inquiry
X12638	PM_6259172	Inquiry
X09425	PM_18425734	Inquiry
X13099	PM_7523264	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of ACV 1 As A Highly Selective Antagonist

Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...

Function of lepirudin in heparin-induced thrombocytopenia

Developed by the German company Hoechst Marion Roussel and derived from genetic modification of hirudin, lepirud ...

Function of phosphoramidon as an endothelin converting enzyme inhibitor

Phosphoramidon is a kind of thermolysin inhibitor isolated from a culture filtrate of streptomyces. It has prove ...

GR 64349, A Selective and Potent NK2 Agonist

GR 64349 is a selective and potent NK2 agonist (EC50 = 3.7 nM in rat colon) with activity comparable to that of ...

Function of NoxA1ds in Colon Cancer

NoxA1ds is derived from a peptide whose structure is based on a short sequence of an essential Nox subunit. It b ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address: