Keywords Search Google Search Search

Neuropeptide Y

Specification Technical Data Related Products Customer reviews and Q&A Useful Tools Publications

CAT#	AF2556
Sequence	YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY
Activity	Antifungal

CAT#	Product Name	Inquiry
AF2389	Def-Bat	Inquiry
AF2293	Brevinin-2ISb	Inquiry
AF1936	Cycloviolacin H3	Inquiry
AF132	Halictine 1	Inquiry
AF056	Theta defensin subunit A	Inquiry

If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.

Customer Support & Price Inquiry

* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).

Recommended Services

Peptide Synthesis Services

Custom Conjugation Service

Peptide PEGylation

Unusual and Non-natural Amino Acids Modification

cGMP Peptide Service

Peptide CDMO

Peptide API Development

Resource

Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!

Function of Psalmotoxin 1 in against pain

Acid-sensitive ion channels (ASICs) are a class of proton-gated ion channels belonging to the Degenerin/Epitheli ...

MC1R antagonist-MSG 606

MSG 606 (Cyclo-[(CH2) 3CO-Gly-His-D-Phe-Arg-D-Trp-Cys(S-)]-Asp-Arg-Phe-Gly-NH2) is a potent and novel cyclic thi ...

Function of Gonadorelin in Infertility

Gonadorelin is a synthetic GnRH, a peptide compound, and a decapeptide whose structure is exactly the same as th ...

Function of dulaglutide in type 2 diabetes

Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...

Function of spadin in neurological treatment of depression

Tandem P-domain weak inward rectifying K+ (TWIK)-related K+ channel 1 (TREK-1) and TWIK-related acid-sensitive K ...

Contact Us

USA

Address:

Tel: |

Email:

Germany

Address:

Host Chemicals	Homo sapiens
Length	36