CAT# | AF2769 |
Sequence | GFGCPNNYACHQHCKSIRGYCGGYCAGWFRLRCTCYRCG |
Activity | Antibacterial, Antifungal |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Norleual is a potent inhibitor of the HGF/Met system, which inhibited the prosurvival effects of HGF and suppres ...
Leuprolide acetate, an acetate salt with similar structure to luteinizing hormone-releasing hormone (LHRH) secre ...
JIP1, a member of the JIPs family, was first discovered to promote JNK activation by combining multiple componen ...
Signal peptides stimulate matrix protein production in general and collagen synthesis in specific. They may be accomplished b ...
Dulaglutide, sold under the brand name Trulicity, is a GLP-1 receptor agonist which is a class of medications th ...