We use cookies to understand how you use our site and to improve the overall user experience. This includes personalizing content and advertising. Read our Privacy Policy
CAT No: L07008
CAS No: 597562-32-8
Synonyms/Alias: 597562-32-8 ;LL-37 (human) trifluoroacetate salt ;ANTIBACTERIAL PROTEIN LL-37 AMIDE (HUMAN) ;LL-37 amide (trifluoroacetate salt) ;LL-37 amide trifluoroacetate salt ;EX-A7429 ;DA-54960 ;CID 137699680 ;
Quick InquiryCustom Peptide SynthesisPeptide Library Construction and Screening
Powerful screening tools in biological and chemical research
M.W/Mr. | 4492.34 |
Sequence | One Letter Code:LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES Three Letter Code:H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-NH2.TFA |
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at info@creative-peptides.com. We will endeavor to provide highly satisfying products and services.
USA
Address: SUITE 115, 17 Ramsey Road, Shirley, NY 11967, USA
Tel: 1-631-624-4882
Fax: 1-631-614-7828
Email: info@creative-peptides.com
Germany
Address: Industriepark Höchst, Gebäude G830
65929 Frankfurt am Main
Email: info@creative-peptides.com