LL-37, Human TFA
LL-37, Human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide, which exhibits a broad spectrum of antimicrobial activity. LL-37, Human TFA could help protect the cornea from infection and modulates wound healing.
Online Inquiry
| CAT# | R1489 |
| M.F/Formula | C₂₀₅H₃₄₀N₆₀O₅₃.C₂HF₃O₂ |
| M.W/Mr. | 4607.28 |
| Sequence | One Letter Code: LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
three Letter Code: Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser |
Write a review
Ask a question
My Review for LL-37, Human TFA
Required fields are marked with *
×
Ask a Question for LL-37, Human TFA
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
