Jingzhaotoxin-III selectively inhibits the activation of the voltage-dependent Nav1.5 channels (IC50 = 350 nM) in heart or cancer cells, but displays no effect on other isoforms,like NaV1.2, NaV1.4, NaV1.6 and NaV1.7. It also inhibits Kv2.1 channel (IC50 = 700 nM).
CAT# | R0983 |
CAS | 925463-91-8 |
Background | Jingzhaotoxin-III (JZTX-III, molecular weight 3919.3 Da) is a peptide toxin containing 36 amino acid residues with three disulfide bridges crosslinked in the pattern of I–IV, II–V, and III–VI (Cys4–Cys19, Cys11–Cys24, and Cys18–Cys31). In previous study, JZTX-III was found to specifically inhibit Nav channels of rat cardiac myocytes with an IC50 of 0.38 μM and followed by shifting activated voltage in a depolarizing direction, on the other hand, JZTX-III is ineffective on Cav and Navchannels of rat DRG cells, thus, JZTX-III might be an ideal tool for analysis of the Nav channels of cardiac myocytes and for pharmacologic exploitation on cardiac related disease. >> Read More |
M.F/Formula | C174H241N47O46S6 |
Sequence | DGECGGFWWKCGRGKPPCCKGYACSKTWGWCAVEAP(Disulfide bridge: Cys4 and Cys19,Cys11 and Cys24,Cys18 and Cys31) |
Labeling Target | NaV1.5 channels |
Appearance | White lyophilised solid |
Purity | >98% |
Activity | Blocker |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Conotoxins are small peptides of 12 to 19 amino acids, which act as highly selective antagonists of ion channel ...
C 21 is a kind of selective protein arginine methyltransferase 1 (PRMT1) inhibitor (IC50 = 1.8 μM). And it exhib ...
Since the discovery of Substance P (SP) in the early 1930s, its pharmacological actions have been extensively studied. SP has ...
PKC (19-36), a synthetic peptide of the pseudosubstrate domain of the kinase, is a selective inhibitor of prote ...
The β-amyloid precursor protein (APP) is connected to Alzheimer's disease by both biochemistry and genetics. As ...