Insulin(cattle)
Insulin cattle is a kind of polypeptide hormone that regulates glucose metabolism in pancreatic islet B-cells.
Online Inquiry
| CAT# | R1453 |
| CAS | 11070-73-8 |
| Synonyms/Alias | Insulin from bovine pancreas |
| M.F/Formula | C₂₅₄H₃₇₇N₆₅O₇₅S₆ |
| M.W/Mr. | 5733.49 |
| Sequence | One Letter Code: FVNQHLCGSHLVEALYLVCGERGFFYTPKA. GIVEQCCASVCSLYQLENYCN (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6'-Cys11')
three Letter Code: Phe-Val-Asn-Gln-His-Leu-Cys-Gly-Ser-His-Leu-Val-Glu-Ala-Leu-Tyr-Leu-Val-Cys-Gly-Glu-Arg-Gly-Phe-Phe-Tyr-Thr-Pro-Lys-Ala. Gly-Ile-Val-Glu-Gln-Cys-Cys-Ala-Ser-Val-Cys-Ser-Leu-Tyr-Gln-Leu-Glu-Asn-Tyr-Cys-Asn (Disulfide bridge: Cys7-Cys7', Cys19-Cys20', Cys6' |
Write a review
Ask a question
My Review for Insulin(cattle)
Required fields are marked with *
×
Ask a Question for Insulin(cattle)
Required fields are marked with *
×
If you have any peptide synthesis requirement in mind, please do not hesitate to contact us at . We will endeavor to provide highly satisfying products and services.
