CAT# | I03007 |
M.F/Formula | C179H281N45O58S |
M.W/Mr. | 4023.53 |
Sequence | IITGLLEFEVYLEYLQNRFESSEEQARAVQMSTK |
* Please kindly note that our products and services can only be used to support research purposes (Not for clinical use).
Creative Peptides has accumulated a huge library of peptide knowledge including frontier peptide articles, application of peptides, useful tools, and more!
Ziconotide (previously called SNX-111), currently marketed under the brand name of Prialt, is the synthetic form ...
Corticotropin (ACTH or adrenocorticotropic hormone) is a linear coupling of 39 amino acid residues and an import ...
Tetracosactide (also known as Tetracosactide) is a synthetic peptide that is identical to the 24-amino acid segm ...
Protirelin is also known as thyrotropin releasing hormone (TRH), a peptide hormone secreted by the hypothalamus. ...
Teicoplanin is a glycopeptide antibiotic developed after vancomycin for the treatment of Gram-positive (G+) cocc ...